Lineage for d1oakl2 (1oak L:108-212)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9078Species Fab NMC-4 (mouse), kappa L chain [49070] (2 PDB entries)
  8. 9082Domain d1oakl2: 1oak L:108-212 [21282]
    Other proteins in same PDB: d1oaka_, d1oakh1, d1oakl1

Details for d1oakl2

PDB Entry: 1oak (more details), 2.2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab

SCOP Domain Sequences for d1oakl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oakl2 b.1.1.2 (L:108-212) Immunoglobulin (constant domains of L and H chains) {Fab NMC-4 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOP Domain Coordinates for d1oakl2:

Click to download the PDB-style file with coordinates for d1oakl2.
(The format of our PDB-style files is described here.)

Timeline for d1oakl2: