Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (17 species) not a true protein |
Species Escherichia coli [TaxId:83333] [225841] (10 PDB entries) |
Domain d3lcwb_: 3lcw B: [212819] automated match to d2wnqa_ complexed with 3py, so4 |
PDB Entry: 3lcw (more details), 2.35 Å
SCOPe Domain Sequences for d3lcwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lcwb_ c.1.10.1 (B:) automated matches {Escherichia coli [TaxId: 83333]} nlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslseraqvl eivaeeakgkikliahvgcvstaesqqlaasakrhgfdavsavtpfyypfsleehcdhyr aiidsadglpmvvynipalsgvkltlgqiytlvtlpgvgalkqtsgdlyqmeqirrehpd lvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkvi dlliktgifrglktvlhymdvisvplcrkpfgpvdekclpelkalaqqlmq
Timeline for d3lcwb_: