SCOPe 2.06: Domain d3lcgc_: 3lcg C:

Lineage for d3lcgc_ (3lcg C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (24 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225841] (10 PDB entries)

8. Domain d3lcgc_: 3lcg C: [212800]
   automated match to d2wnqa_
   complexed with so4; mutant

Details for d3lcgc_

PDB Entry: 3lcg, 1.78 Å

PDB Description: the d-sialic acid aldolase mutant v251l

PDB Compounds: (C:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d3lcgc_:

Sequence; same for both SEQRES and ATOM records:

>d3lcgc_ c.1.10.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereqv
leivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdhy
raiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirrehp
dlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnkv
idlliktglfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqer

Timeline for d3lcgc_:

• d3lcgc_ first appeared in SCOPe 2.03
  
• d3lcgc_ appears in SCOPe 2.05
  
• d3lcgc_ appears in SCOPe 2.07
  
• d3lcgc_ appears in the current release, SCOPe 2.08