Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins) |
Protein automated matches [190140] (13 species) not a true protein |
Species Escherichia coli [TaxId:562] [189978] (6 PDB entries) |
Domain d3lc8b_: 3lc8 B: [212793] automated match to d1a7lb_ complexed with gol, mg, pg4 |
PDB Entry: 3lc8 (more details), 2 Å
SCOPe Domain Sequences for d3lc8b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lc8b_ c.94.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]} egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp nppktweeipaldrelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd aadpgydsiiyrmt
Timeline for d3lc8b_: