SCOPe 2.03: Domain d3lc8b_: 3lc8 B:

Lineage for d3lc8b_ (3lc8 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein automated matches [190140] (13 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189978] (6 PDB entries)

8. Domain d3lc8b_: 3lc8 B: [212793]
   automated match to d1a7lb_
   complexed with gol, mg, pg4

Details for d3lc8b_

PDB Entry: 3lc8, 2 Å

PDB Description: crystal structure of the cytoplasmic tail of (pro)renin receptor as a mbp fusion (maltose-free form)

PDB Compounds: (B:) Maltose-binding periplasmic protein, Renin receptor

SCOPe Domain Sequences for d3lc8b_:

Sequence; same for both SEQRES and ATOM records:

>d3lc8b_ c.94.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
egklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwa
hdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllp
nppktweeipaldrelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgv
dnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnyg
vtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgava
lksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkd
aadpgydsiiyrmt

Timeline for d3lc8b_:

• d3lc8b_ is new in SCOPe 2.03-stable
  
• d3lc8b_ appears in SCOPe 2.04
  
• d3lc8b_ appears in the current release, SCOPe 2.08