Lineage for d3lc8a_ (3lc8 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1879042Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1879043Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1879044Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)
  6. 1879927Protein automated matches [190140] (18 species)
    not a true protein
  7. 1880001Species Escherichia coli [TaxId:562] [189978] (6 PDB entries)
  8. 1880005Domain d3lc8a_: 3lc8 A: [212792]
    automated match to d1a7lb_
    complexed with gol, mg, pg4

Details for d3lc8a_

PDB Entry: 3lc8 (more details), 2 Å

PDB Description: crystal structure of the cytoplasmic tail of (pro)renin receptor as a mbp fusion (maltose-free form)
PDB Compounds: (A:) Maltose-binding periplasmic protein, Renin receptor

SCOPe Domain Sequences for d3lc8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lc8a_ c.94.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
eegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifw
ahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdll
pnppktweeipaldrelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvg
vdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvny
gvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgav
alksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealk
daadpgydsiiy

SCOPe Domain Coordinates for d3lc8a_:

Click to download the PDB-style file with coordinates for d3lc8a_.
(The format of our PDB-style files is described here.)

Timeline for d3lc8a_: