SCOPe 2.08: Domain d3lbsb_: 3lbs B:

Lineage for d3lbsb_ (3lbs B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189406] (17 PDB entries)

8. Domain d3lbsb_: 3lbs B: [212791]
   automated match to d1a7lb_

Details for d3lbsb_

PDB Entry: 3lbs, 2.15 Å

PDB Description: crystal structure of the cytoplasmic tail of (pro)renin receptor as a mbp fusion (maltose-bound form)

PDB Compounds: (B:) Maltose-binding periplasmic protein, Renin receptor

SCOPe Domain Sequences for d3lbsb_:

Sequence; same for both SEQRES and ATOM records:

>d3lbsb_ c.94.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifw
ahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdll
pnppktweeipaldrelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvg
vdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvny
gvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgav
alksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealk
daadpgydsiiyrmtn

Timeline for d3lbsb_:

• d3lbsb_ first appeared in SCOPe 2.03
  
• d3lbsb_ appears in SCOPe 2.07