Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
Domain d1a0qh2: 1a0q H:115-211 [21279] Other proteins in same PDB: d1a0qh1, d1a0ql1, d1a0ql2 part of catalytic antibody 29G11 with esterase activity complexed with hep, zn |
PDB Entry: 1a0q (more details), 2.3 Å
SCOP Domain Sequences for d1a0qh2:
Sequence, based on SEQRES records: (download)
>d1a0qh2 b.1.1.2 (H:115-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl ytlsssvtvpsstwpsetvtcnvahpasstkvdkkie
>d1a0qh2 b.1.1.2 (H:115-211) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv tvpsstwpsetvtcnvahpasstkvdkkie
Timeline for d1a0qh2: