SCOP 1.61: Domain d1a0qh2: 1a0q H:115-211

Lineage for d1a0qh2 (1a0q H:115-211)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab 29G11 (mouse), kappa L chain [49069] (1 PDB entry)

8. Domain d1a0qh2: 1a0q H:115-211 [21279]
   Other proteins in same PDB: d1a0qh1, d1a0ql1

Details for d1a0qh2

PDB Entry: 1a0q, 2.3 Å

PDB Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate

SCOP Domain Sequences for d1a0qh2:

Sequence, based on SEQRES records:

>d1a0qh2 b.1.1.2 (H:115-211) Immunoglobulin (constant domains of L and H chains) {Fab 29G11 (mouse), kappa L chain}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkie

Sequence, based on observed residues (ATOM records):

>d1a0qh2 b.1.1.2 (H:115-211) Immunoglobulin (constant domains of L and H chains) {Fab 29G11 (mouse), kappa L chain}
kttppsvyplapsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssv
tvpsstwpsetvtcnvahpasstkvdkkie

Timeline for d1a0qh2:

• d1a0qh2 first appeared (with stable ids) in SCOP 1.55
  
• d1a0qh2 appears in SCOP 1.59
  
• d1a0qh2 appears in SCOP 1.63
  
• d1a0qh2 appears in the current release, SCOPe 2.08