SCOPe 2.05: Domain d3lb5b_: 3lb5 B:

Lineage for d3lb5b_ (3lb5 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.13: HIT-like [54196] (2 superfamilies)
   alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha

4. Superfamily d.13.1: HIT-like [54197] (5 families)

5. Family d.13.1.0: automated matches [191614] (1 protein)
   not a true family

6. Protein automated matches [191122] (9 species)
   not a true protein

7. Species Bartonella henselae [TaxId:38323] [225815] (1 PDB entry)

8. Domain d3lb5b_: 3lb5 B: [212777]
   automated match to d3ksva_
   complexed with unl

Details for d3lb5b_

PDB Entry: 3lb5, 1.9 Å

PDB Description: Crystal structure of Hit-like protein involved in cell-cycle regulation from Bartonella henselae with unknown ligand

PDB Compounds: (B:) Hit-like protein involved in cell-cycle regulation

SCOPe Domain Sequences for d3lb5b_:

Sequence, based on SEQRES records:

>d3lb5b_ d.13.1.0 (B:) automated matches {Bartonella henselae [TaxId: 38323]}
qaydnnnifaklirneipsvrvyedddviafmdimpqapghtlvipkkgsrnlldadtet
lfpvikavqkiakavkkafqadgitvmqfneaasqqtvyhlhfhiiprmegieltphnni
itpteileenakkiraal

Sequence, based on observed residues (ATOM records):

>d3lb5b_ d.13.1.0 (B:) automated matches {Bartonella henselae [TaxId: 38323]}
qaydnnnifaklirneipsvrvyedddviafmdimpqapghtlvipkkgsrnlldadtet
lfpvikavqkiakavkkafqadgitvmqfneaasqqtvyhlhfhiiprmegienniitpt
eileenakkiraal

Timeline for d3lb5b_:

• d3lb5b_ first appeared in SCOPe 2.03
  
• d3lb5b_ appears in SCOPe 2.04
  
• d3lb5b_ appears in SCOPe 2.06
  
• d3lb5b_ appears in the current release, SCOPe 2.08