![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.0: automated matches [191614] (1 protein) not a true family |
![]() | Protein automated matches [191122] (10 species) not a true protein |
![]() | Species Bartonella henselae [TaxId:38323] [225815] (1 PDB entry) |
![]() | Domain d3lb5b_: 3lb5 B: [212777] automated match to d3ksva_ complexed with unl |
PDB Entry: 3lb5 (more details), 1.9 Å
SCOPe Domain Sequences for d3lb5b_:
Sequence, based on SEQRES records: (download)
>d3lb5b_ d.13.1.0 (B:) automated matches {Bartonella henselae [TaxId: 38323]} qaydnnnifaklirneipsvrvyedddviafmdimpqapghtlvipkkgsrnlldadtet lfpvikavqkiakavkkafqadgitvmqfneaasqqtvyhlhfhiiprmegieltphnni itpteileenakkiraal
>d3lb5b_ d.13.1.0 (B:) automated matches {Bartonella henselae [TaxId: 38323]} qaydnnnifaklirneipsvrvyedddviafmdimpqapghtlvipkkgsrnlldadtet lfpvikavqkiakavkkafqadgitvmqfneaasqqtvyhlhfhiiprmegienniitpt eileenakkiraal
Timeline for d3lb5b_: