Lineage for d3lb5a_ (3lb5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929994Family d.13.1.0: automated matches [191614] (1 protein)
    not a true family
  6. 2929995Protein automated matches [191122] (10 species)
    not a true protein
  7. 2929996Species Bartonella henselae [TaxId:38323] [225815] (1 PDB entry)
  8. 2929997Domain d3lb5a_: 3lb5 A: [212776]
    automated match to d3ksva_
    complexed with unl

Details for d3lb5a_

PDB Entry: 3lb5 (more details), 1.9 Å

PDB Description: Crystal structure of Hit-like protein involved in cell-cycle regulation from Bartonella henselae with unknown ligand
PDB Compounds: (A:) Hit-like protein involved in cell-cycle regulation

SCOPe Domain Sequences for d3lb5a_:

Sequence, based on SEQRES records: (download)

>d3lb5a_ d.13.1.0 (A:) automated matches {Bartonella henselae [TaxId: 38323]}
aydnnnifaklirneipsvrvyedddviafmdimpqapghtlvipkkgsrnlldadtetl
fpvikavqkiakavkkafqadgitvmqfneaasqqtvyhlhfhiiprmegieltphnnii
tpteileenakkiraal

Sequence, based on observed residues (ATOM records): (download)

>d3lb5a_ d.13.1.0 (A:) automated matches {Bartonella henselae [TaxId: 38323]}
aydnnnifaklirneipsvrvyedddviafmdimpqapghtlvipkkgsrnlldadtetl
fpvikavqkiakavkkafqadgitvmqfneaasqqtvyhlhfhiiprmegielitpteil
eenakkiraal

SCOPe Domain Coordinates for d3lb5a_:

Click to download the PDB-style file with coordinates for d3lb5a_.
(The format of our PDB-style files is described here.)

Timeline for d3lb5a_: