SCOPe 2.05: Domain d3lala2: 3lal A:430-553

Lineage for d3lala2 (3lal A:430-553)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (101 PDB entries)
   Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595

8. Domain d3lala2: 3lal A:430-553 [212769]
   Other proteins in same PDB: d3lala1
   automated match to d1c1ba1
   complexed with krv, so4

Details for d3lala2

PDB Entry: 3lal, 2.51 Å

PDB Description: Crystal structure of HIV-1 reverse transcriptase in complex with N1-ethyl pyrimidinedione non-nucleoside inhibitor

PDB Compounds: (A:) HIV Reverse transcriptase

SCOPe Domain Sequences for d3lala2:

Sequence; same for both SEQRES and ATOM records:

>d3lala2 c.55.3.1 (A:430-553) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvs

Timeline for d3lala2:

• d3lala2 first appeared in SCOPe 2.03
  
• d3lala2 appears in SCOPe 2.04
  
• d3lala2 appears in SCOPe 2.06
  
• d3lala2 appears in the current release, SCOPe 2.08