SCOPe 2.05: Domain d3l9ca1: 3l9c A:0-225

Lineage for d3l9ca1 (3l9c A:0-225)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (63 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [226048] (1 PDB entry)

8. Domain d3l9ca1: 3l9c A:0-225 [212760]
   automated match to d3m7wa_

Details for d3l9ca1

PDB Entry: 3l9c, 1.6 Å

PDB Description: The Crystal Structure of smu.777 from Streptococcus mutans UA159

PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3l9ca1:

Sequence, based on SEQRES records:

>d3l9ca1 c.1.10.0 (A:0-225) automated matches {Streptococcus mutans [TaxId: 210007]}
smkivvpvmpqnieeanqldltridstdiiewradylvkddiltvapaifekfsghevif
tlrtekeggnislsnedylaiirdiaalyqpdyidfeyfsyrdvleemydfsnlilsyhn
feetpenlmevfseltalaprvvkiavmpkneqdvldlmnytrgfktlnpnqeyvtmsms
klgrisrlaadligsswtfasleqesapgqisladmrkikevldan

Sequence, based on observed residues (ATOM records):

>d3l9ca1 c.1.10.0 (A:0-225) automated matches {Streptococcus mutans [TaxId: 210007]}
smkivvpvmpqnieeanqldltridstdiiewradylvkddiltvapaifekfsghevif
tlrtekeggnislsnedylaiirdiaalyqpdyidfeyfsyrdvleemydfsnlilsyhn
feetpenlmevfseltalaprvvkiavmpkneqdvldlmnytrgfktlnpnqeyvtmsms
klgrisrlaadligsswtfaslqisladmrkikevldan

Timeline for d3l9ca1:

• d3l9ca1 first appeared in SCOPe 2.03
  
• d3l9ca1 appears in SCOPe 2.04
  
• d3l9ca1 appears in SCOPe 2.06
  
• d3l9ca1 appears in the current release, SCOPe 2.08