SCOPe 2.04: Domain d3l7uc_: 3l7u C:

Lineage for d3l7uc_ (3l7u C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein Nucleoside diphosphate kinase, NDK [54921] (23 species)

7. Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (6 PDB entries)

8. Domain d3l7uc_: 3l7u C: [212757]
   automated match to d4enoa_
   complexed with po4

Details for d3l7uc_

PDB Entry: 3l7u, 2.1 Å

PDB Description: Crystal structure of human NM23-H1

PDB Compounds: (C:) Nucleoside Diphosphate Kinase A

SCOPe Domain Sequences for d3l7uc_:

Sequence; same for both SEQRES and ATOM records:

>d3l7uc_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]}
mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf
faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs
dsvesaekeiglwfhpeelvdytscaqnwiye

Timeline for d3l7uc_:

• d3l7uc_ first appeared in SCOPe 2.03
  
• d3l7uc_ appears in SCOPe 2.05
  
• d3l7uc_ appears in the current release, SCOPe 2.08