Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein Nucleoside diphosphate kinase, NDK [54921] (23 species) |
Species Human (Homo sapiens), NDKA [TaxId:9606] [75437] (6 PDB entries) |
Domain d3l7ua_: 3l7u A: [212755] Other proteins in same PDB: d3l7ub2 automated match to d4enoa_ complexed with po4 |
PDB Entry: 3l7u (more details), 2.1 Å
SCOPe Domain Sequences for d3l7ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l7ua_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDKA [TaxId: 9606]} mancertfiaikpdgvqrglvgeiikrfeqkgfrlvglkfmqasedllkehyvdlkdrpf faglvkymhsgpvvamvweglnvvktgrvmlgetnpadskpgtirgdfciqvgrniihgs dsvesaekeiglwfhpeelvdytscaqnwiye
Timeline for d3l7ua_: