Lineage for d3l7el2 (3l7e L:108-213)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (522 PDB entries)
  8. 2354097Domain d3l7el2: 3l7e L:108-213 [212748]
    Other proteins in same PDB: d3l7ea1, d3l7el1
    automated match to d1rhha2
    complexed with act, gol, so4

Details for d3l7el2

PDB Entry: 3l7e (more details), 2.5 Å

PDB Description: Crystal structure of ANTI-IL-13 antibody C836
PDB Compounds: (L:) c836 light chain

SCOPe Domain Sequences for d3l7el2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l7el2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d3l7el2:

Click to download the PDB-style file with coordinates for d3l7el2.
(The format of our PDB-style files is described here.)

Timeline for d3l7el2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3l7el1