SCOPe 2.07: Domain d3l7el1: 3l7e L:1-107

Lineage for d3l7el1 (3l7e L:1-107)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3l7el1: 3l7e L:1-107 [212747]
   Other proteins in same PDB: d3l7ea2, d3l7el2
   automated match to d1rhha1
   complexed with act, gol, so4

Details for d3l7el1

PDB Entry: 3l7e, 2.5 Å

PDB Description: Crystal structure of ANTI-IL-13 antibody C836

PDB Compounds: (L:) c836 light chain

SCOPe Domain Sequences for d3l7el1:

Sequence; same for both SEQRES and ATOM records:

>d3l7el1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvqitqspsylaaspgetitlncrasksiskylawyqekpgktnklliysgstlqsgips
rfsgsgsgtdftltisslepedfamyfcqqhneypytfgggtkleik

Timeline for d3l7el1:

• d3l7el1 first appeared in SCOPe 2.03
  
• d3l7el1 appears in SCOPe 2.06
  
• d3l7el1 appears in the current release, SCOPe 2.08