Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Cryptosporidium parvum [TaxId:353152] [225813] (2 PDB entries) |
Domain d3l6qb1: 3l6q B:19-204 [212743] Other proteins in same PDB: d3l6qa3, d3l6qb3 automated match to d2qw9a1 complexed with mg, so4 |
PDB Entry: 3l6q (more details), 2.29 Å
SCOPe Domain Sequences for d3l6qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l6qb1 c.55.1.0 (B:19-204) automated matches {Cryptosporidium parvum [TaxId: 353152]} gpaigidlgttyscvgvwrndtvdivpndqgnrttpsyvafteterligdaaknqvarnp entvfdakrligrkfddqavqsdmthwpfkvvrgpkdkpiisvnylgekkefhaeeisam vlqkmkeiseaylgrqiknavvtvpayfndsqrqatkdagaiaglnvmriineptaaaia ygldkk
Timeline for d3l6qb1: