Lineage for d3l6qb1 (3l6q B:19-204)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2884975Species Cryptosporidium parvum [TaxId:353152] [225813] (2 PDB entries)
  8. 2884982Domain d3l6qb1: 3l6q B:19-204 [212743]
    Other proteins in same PDB: d3l6qa3, d3l6qb3
    automated match to d2qw9a1
    complexed with mg, so4

Details for d3l6qb1

PDB Entry: 3l6q (more details), 2.29 Å

PDB Description: crystal structure of the n-terminal domain of hsp70 from cryptosporidium parvum (cgd2_20)
PDB Compounds: (B:) Heat shock 70 (HSP70) protein

SCOPe Domain Sequences for d3l6qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l6qb1 c.55.1.0 (B:19-204) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gpaigidlgttyscvgvwrndtvdivpndqgnrttpsyvafteterligdaaknqvarnp
entvfdakrligrkfddqavqsdmthwpfkvvrgpkdkpiisvnylgekkefhaeeisam
vlqkmkeiseaylgrqiknavvtvpayfndsqrqatkdagaiaglnvmriineptaaaia
ygldkk

SCOPe Domain Coordinates for d3l6qb1:

Click to download the PDB-style file with coordinates for d3l6qb1.
(The format of our PDB-style files is described here.)

Timeline for d3l6qb1: