Class b: All beta proteins [48724] (178 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [225876] (3 PDB entries) |
Domain d3l2ma2: 3l2m A:404-496 [212734] Other proteins in same PDB: d3l2ma1 automated match to d1jfha1 complexed with ca, cl, glc |
PDB Entry: 3l2m (more details), 1.97 Å
SCOPe Domain Sequences for d3l2ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2ma2 b.71.1.0 (A:404-496) automated matches {Pig (Sus scrofa) [TaxId: 9823]} qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct gikvyvssdgtaqfsisnsaedpfiaihaeskl
Timeline for d3l2ma2: