SCOPe 2.03: Domain d3l2ma2: 3l2m A:404-496

Lineage for d3l2ma2 (3l2m A:404-496)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (18 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [225876] (2 PDB entries)

8. Domain d3l2ma2: 3l2m A:404-496 [212734]
   Other proteins in same PDB: d3l2ma1
   automated match to d1jfha1
   complexed with ca, cl

Details for d3l2ma2

PDB Entry: 3l2m, 1.97 Å

PDB Description: x-ray crystallographic analysis of pig pancreatic alpha-amylase with alpha-cyclodextrin

PDB Compounds: (A:) Pancreatic alpha-amylase

SCOPe Domain Sequences for d3l2ma2:

Sequence; same for both SEQRES and ATOM records:

>d3l2ma2 b.71.1.0 (A:404-496) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

Timeline for d3l2ma2:

• d3l2ma2 is new in SCOPe 2.03-stable
  
• d3l2ma2 appears in SCOPe 2.04
  
• d3l2ma2 appears in the current release, SCOPe 2.08