Lineage for d3l2la1 (3l2l A:1-403)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339758Protein automated matches [190099] (14 species)
    not a true protein
  7. 1339798Species Pig (Sus scrofa) [TaxId:9823] [225875] (2 PDB entries)
  8. 1339800Domain d3l2la1: 3l2l A:1-403 [212731]
    Other proteins in same PDB: d3l2la2
    automated match to d1jfha2
    complexed with ca, cl, glc

Details for d3l2la1

PDB Entry: 3l2l (more details), 2.11 Å

PDB Description: x-ray crystallographic analysis of pig pancreatic alpha-amylase with limit dextrin and oligosaccharide
PDB Compounds: (A:) Pancreatic alpha-amylase

SCOPe Domain Sequences for d3l2la1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2la1 c.1.8.1 (A:1-403) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgnrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aiqsseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggasiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngqdvndwigp
pnnngvikevtinadttcgndwvcehrwrqirnmvwfrnvvdg

SCOPe Domain Coordinates for d3l2la1:

Click to download the PDB-style file with coordinates for d3l2la1.
(The format of our PDB-style files is described here.)

Timeline for d3l2la1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3l2la2