Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein automated matches [190099] (31 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [225875] (3 PDB entries) |
Domain d3l2la1: 3l2l A:1-403 [212731] Other proteins in same PDB: d3l2la2 automated match to d1jfha2 complexed with ca, cl, glc |
PDB Entry: 3l2l (more details), 2.11 Å
SCOPe Domain Sequences for d3l2la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2la1 c.1.8.1 (A:1-403) automated matches {Pig (Sus scrofa) [TaxId: 9823]} eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn pgnrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge aiqsseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd nqrghgaggasiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngqdvndwigp pnnngvikevtinadttcgndwvcehrwrqirnmvwfrnvvdg
Timeline for d3l2la1: