SCOPe 2.08: Domain d3l2la1: 3l2l A:1-403

Lineage for d3l2la1 (3l2l A:1-403)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (31 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [225875] (3 PDB entries)

8. Domain d3l2la1: 3l2l A:1-403 [212731]
   Other proteins in same PDB: d3l2la2
   automated match to d1jfha2
   complexed with ca, cl, glc

Details for d3l2la1

PDB Entry: 3l2l, 2.11 Å

PDB Description: x-ray crystallographic analysis of pig pancreatic alpha-amylase with limit dextrin and oligosaccharide

PDB Compounds: (A:) Pancreatic alpha-amylase

SCOPe Domain Sequences for d3l2la1:

Sequence; same for both SEQRES and ATOM records:

>d3l2la1 c.1.8.1 (A:1-403) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgnrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aiqsseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggasiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngqdvndwigp
pnnngvikevtinadttcgndwvcehrwrqirnmvwfrnvvdg

Timeline for d3l2la1:

• d3l2la1 first appeared in SCOPe 2.03
  
• d3l2la1 appears in SCOPe 2.07