Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Salmonella enterica [TaxId:99287] [226761] (5 PDB entries) |
Domain d3l2ib1: 3l2i B:1-251 [212730] Other proteins in same PDB: d3l2ia2, d3l2ib2 automated match to d4h3dd_ complexed with mg |
PDB Entry: 3l2i (more details), 1.85 Å
SCOPe Domain Sequences for d3l2ib1:
Sequence, based on SEQRES records: (download)
>d3l2ib1 c.1.10.0 (B:1-251) automated matches {Salmonella enterica [TaxId: 99287]} mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva dlrtvltilhq
>d3l2ib1 c.1.10.0 (B:1-251) automated matches {Salmonella enterica [TaxId: 99287]} mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavgqisvadlrtvl tilhq
Timeline for d3l2ib1: