![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries) |
![]() | Domain d1adqh2: 1adq H:114-223B [21273] Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh1, d1adql1, d1adql2 part of IgM rheumatoid factor Fab |
PDB Entry: 1adq (more details), 3.15 Å
SCOPe Domain Sequences for d1adqh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1adqh2 b.1.1.2 (H:114-223B) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr ggkyaatsqvllpskdvmqgtnehvvckvqhpngnkekdvpl
Timeline for d1adqh2:
![]() Domains from other chains: (mouse over for more information) d1adqa1, d1adqa2, d1adql1, d1adql2 |