Lineage for d1adqh2 (1adq H:114-223B)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289603Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
  7. 289604Species Human (Homo sapiens) [TaxId:9606] [88583] (5 PDB entries)
  8. 289614Domain d1adqh2: 1adq H:114-223B [21273]
    Other proteins in same PDB: d1adqa1, d1adqa2, d1adqh1, d1adql1, d1adql2
    part of IgM rheumatoid factor Fab

Details for d1adqh2

PDB Entry: 1adq (more details), 3.15 Å

PDB Description: crystal structure of a human igm rheumatoid factor fab in complex with its autoantigen igg fc

SCOP Domain Sequences for d1adqh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1adqh2 b.1.1.2 (H:114-223B) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens)}
gsasaptlfplvscensnpsstvavgclaqdflpdsitfswkyknnsdisstrgfpsvlr
ggkyaatsqvllpskdvmqgtnehvvckvqhpngnkekdvpl

SCOP Domain Coordinates for d1adqh2:

Click to download the PDB-style file with coordinates for d1adqh2.
(The format of our PDB-style files is described here.)

Timeline for d1adqh2: