Lineage for d3l2ia1 (3l2i A:1-251)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086868Species Salmonella enterica [TaxId:99287] [226761] (5 PDB entries)
  8. 2086875Domain d3l2ia1: 3l2i A:1-251 [212729]
    Other proteins in same PDB: d3l2ia2, d3l2ib2
    automated match to d4h3dd_
    complexed with mg

Details for d3l2ia1

PDB Entry: 3l2i (more details), 1.85 Å

PDB Description: 1.85 angstrom crystal structure of the 3-dehydroquinate dehydratase (arod) from salmonella typhimurium lt2.
PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d3l2ia1:

Sequence, based on SEQRES records: (download)

>d3l2ia1 c.1.10.0 (A:1-251) automated matches {Salmonella enterica [TaxId: 99287]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva
dlrtvltilhq

Sequence, based on observed residues (ATOM records): (download)

>d3l2ia1 c.1.10.0 (A:1-251) automated matches {Salmonella enterica [TaxId: 99287]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipkiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkapgqisvadlr
tvltilhq

SCOPe Domain Coordinates for d3l2ia1:

Click to download the PDB-style file with coordinates for d3l2ia1.
(The format of our PDB-style files is described here.)

Timeline for d3l2ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3l2ia2