SCOPe 2.08: Domain d3l2go1: 3l2g O:24-113

Lineage for d3l2go1 (3l2g O:24-113)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (9 species)
   not a true protein

7. Species Namalycastis sp. [TaxId:243920] [225846] (4 PDB entries)

8. Domain d3l2go1: 3l2g O:24-113 [212721]
   Other proteins in same PDB: d3l2ga2, d3l2gb2, d3l2gc2, d3l2gd2, d3l2ge2, d3l2gf2, d3l2gg2, d3l2gh2, d3l2gi2, d3l2gj2, d3l2gk2, d3l2gl2, d3l2gm2, d3l2gn2, d3l2go2, d3l2gp2, d3l2gq2, d3l2gr2
   complexed with adp, mg, nmg, no3
   complexed with adp, mg, nmg, no3

Details for d3l2go1

PDB Entry: 3l2g, 2.3 Å

PDB Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp., with transition state analog Mg(II)-ADP-NO3-glycocyamine. Part 2.

PDB Compounds: (O:) Glycocyamine kinase beta chain

SCOPe Domain Sequences for d3l2go1:

Sequence; same for both SEQRES and ATOM records:

>d3l2go1 a.83.1.0 (O:24-113) automated matches {Namalycastis sp. [TaxId: 243920]}
kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
tgcvfgdeysyecykeffdkcieeihhfkp

Timeline for d3l2go1:

• d3l2go1 first appeared in SCOPe 2.03
  
• d3l2go1 appears in SCOPe 2.07