| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) ![]() |
| Family d.128.1.0: automated matches [227250] (1 protein) not a true family |
| Protein automated matches [227028] (6 species) not a true protein |
| Species Namalycastis sp. [TaxId:243920] [225847] (4 PDB entries) |
| Domain d3l2gn2: 3l2g N:114-390 [212720] Other proteins in same PDB: d3l2ga1, d3l2gb1, d3l2gc1, d3l2gd1, d3l2ge1, d3l2gf1, d3l2gg1, d3l2gh1, d3l2gi1, d3l2gj1, d3l2gk1, d3l2gl1, d3l2gm1, d3l2gn1, d3l2go1, d3l2gp1, d3l2gq1, d3l2gr1 complexed with adp, mg, nmg, no3 complexed with adp, mg, nmg, no3 |
PDB Entry: 3l2g (more details), 2.3 Å
SCOPe Domain Sequences for d3l2gn2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2gn2 d.128.1.0 (N:114-390) automated matches {Namalycastis sp. [TaxId: 243920]}
sdkhpapdldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdal
gglkgdlagkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnne
knflvwineedhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyict
cptnmgtvvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarl
gkserelvqvlvdgvnlliacdkkleagqsiddmipk
Timeline for d3l2gn2:
View in 3DDomains from other chains: (mouse over for more information) d3l2ga1, d3l2ga2, d3l2gb1, d3l2gb2, d3l2gc1, d3l2gc2, d3l2gd1, d3l2gd2, d3l2ge1, d3l2ge2, d3l2gf1, d3l2gf2, d3l2gg1, d3l2gg2, d3l2gh1, d3l2gh2, d3l2gi1, d3l2gi2, d3l2gj1, d3l2gj2, d3l2gk1, d3l2gk2, d3l2gl1, d3l2gl2, d3l2gm1, d3l2gm2, d3l2go1, d3l2go2, d3l2gp1, d3l2gp2, d3l2gq1, d3l2gq2, d3l2gr1, d3l2gr2 |