| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
| Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
| Protein automated matches [226884] (9 species) not a true protein |
| Species Namalycastis sp. [TaxId:243920] [225846] (4 PDB entries) |
| Domain d3l2gn1: 3l2g N:9-113 [212719] Other proteins in same PDB: d3l2ga2, d3l2gb2, d3l2gc2, d3l2gd2, d3l2ge2, d3l2gf2, d3l2gg2, d3l2gh2, d3l2gi2, d3l2gj2, d3l2gk2, d3l2gl2, d3l2gm2, d3l2gn2, d3l2go2, d3l2gp2, d3l2gq2, d3l2gr2 complexed with adp, mg, nmg, no3 complexed with adp, mg, nmg, no3 |
PDB Entry: 3l2g (more details), 2.3 Å
SCOPe Domain Sequences for d3l2gn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2gn1 a.83.1.0 (N:9-113) automated matches {Namalycastis sp. [TaxId: 243920]}
fvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkci
qtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkp
Timeline for d3l2gn1:
View in 3DDomains from other chains: (mouse over for more information) d3l2ga1, d3l2ga2, d3l2gb1, d3l2gb2, d3l2gc1, d3l2gc2, d3l2gd1, d3l2gd2, d3l2ge1, d3l2ge2, d3l2gf1, d3l2gf2, d3l2gg1, d3l2gg2, d3l2gh1, d3l2gh2, d3l2gi1, d3l2gi2, d3l2gj1, d3l2gj2, d3l2gk1, d3l2gk2, d3l2gl1, d3l2gl2, d3l2gm1, d3l2gm2, d3l2go1, d3l2go2, d3l2gp1, d3l2gp2, d3l2gq1, d3l2gq2, d3l2gr1, d3l2gr2 |