Lineage for d12e8p2 (12e8 P:115-214)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549247Domain d12e8p2: 12e8 P:115-214 [21271]
    Other proteins in same PDB: d12e8h1, d12e8l1, d12e8l2, d12e8m1, d12e8m2, d12e8p1
    part of Fab 2E8 specific to the low density lipoprotein receptor binding region of apolipoprotein E

Details for d12e8p2

PDB Entry: 12e8 (more details), 1.9 Å

PDB Description: 2e8 fab fragment

SCOP Domain Sequences for d12e8p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d12e8p2 b.1.1.2 (P:115-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d12e8p2:

Click to download the PDB-style file with coordinates for d12e8p2.
(The format of our PDB-style files is described here.)

Timeline for d12e8p2: