Lineage for d3l2gi1 (3l2g I:24-113)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1740708Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 1740709Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 1740768Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 1740769Protein automated matches [226884] (6 species)
    not a true protein
  7. 1740800Species Namalycastis sp. [TaxId:243920] [225846] (4 PDB entries)
  8. 1740835Domain d3l2gi1: 3l2g I:24-113 [212709]
    Other proteins in same PDB: d3l2ga2, d3l2gb2, d3l2gc2, d3l2gd2, d3l2ge2, d3l2gf2, d3l2gg2, d3l2gh2, d3l2gi2, d3l2gj2, d3l2gk2, d3l2gl2, d3l2gm2, d3l2gn2, d3l2go2, d3l2gp2, d3l2gq2, d3l2gr2
    complexed with adp, mg, nmg, no3
    complexed with adp, mg, nmg, no3

Details for d3l2gi1

PDB Entry: 3l2g (more details), 2.3 Å

PDB Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp., with transition state analog Mg(II)-ADP-NO3-glycocyamine. Part 2.
PDB Compounds: (I:) Glycocyamine kinase beta chain

SCOPe Domain Sequences for d3l2gi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2gi1 a.83.1.0 (I:24-113) automated matches {Namalycastis sp. [TaxId: 243920]}
kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
tgcvfgdeysyecykeffdkcieeihhfkp

SCOPe Domain Coordinates for d3l2gi1:

Click to download the PDB-style file with coordinates for d3l2gi1.
(The format of our PDB-style files is described here.)

Timeline for d3l2gi1: