SCOPe 2.08: Domain d3l2gg2: 3l2g G:114-390

Lineage for d3l2gg2 (3l2g G:114-390)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (6 species)
   not a true protein

7. Species Namalycastis sp. [TaxId:243920] [225847] (4 PDB entries)

8. Domain d3l2gg2: 3l2g G:114-390 [212706]
   Other proteins in same PDB: d3l2ga1, d3l2gb1, d3l2gc1, d3l2gd1, d3l2ge1, d3l2gf1, d3l2gg1, d3l2gh1, d3l2gi1, d3l2gj1, d3l2gk1, d3l2gl1, d3l2gm1, d3l2gn1, d3l2go1, d3l2gp1, d3l2gq1, d3l2gr1
   complexed with adp, mg, nmg, no3
   complexed with adp, mg, nmg, no3

Details for d3l2gg2

PDB Entry: 3l2g, 2.3 Å

PDB Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp., with transition state analog Mg(II)-ADP-NO3-glycocyamine. Part 2.

PDB Compounds: (G:) Glycocyamine kinase beta chain

SCOPe Domain Sequences for d3l2gg2:

Sequence; same for both SEQRES and ATOM records:

>d3l2gg2 d.128.1.0 (G:114-390) automated matches {Namalycastis sp. [TaxId: 243920]}
sdkhpapdldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdal
gglkgdlagkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnne
knflvwineedhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyict
cptnmgtvvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarl
gkserelvqvlvdgvnlliacdkkleagqsiddmipk

Timeline for d3l2gg2:

• d3l2gg2 first appeared in SCOPe 2.03
  
• d3l2gg2 appears in SCOPe 2.07