Lineage for d3l2ge2 (3l2g E:114-390)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581287Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2581288Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2581562Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2581563Protein automated matches [227028] (6 species)
    not a true protein
  7. 2581691Species Namalycastis sp. [TaxId:243920] [225847] (4 PDB entries)
  8. 2581722Domain d3l2ge2: 3l2g E:114-390 [212702]
    Other proteins in same PDB: d3l2ga1, d3l2gb1, d3l2gc1, d3l2gd1, d3l2ge1, d3l2gf1, d3l2gg1, d3l2gh1, d3l2gi1, d3l2gj1, d3l2gk1, d3l2gl1, d3l2gm1, d3l2gn1, d3l2go1, d3l2gp1, d3l2gq1, d3l2gr1
    complexed with adp, mg, nmg, no3
    complexed with adp, mg, nmg, no3

Details for d3l2ge2

PDB Entry: 3l2g (more details), 2.3 Å

PDB Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp., with transition state analog Mg(II)-ADP-NO3-glycocyamine. Part 2.
PDB Compounds: (E:) Glycocyamine kinase beta chain

SCOPe Domain Sequences for d3l2ge2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2ge2 d.128.1.0 (E:114-390) automated matches {Namalycastis sp. [TaxId: 243920]}
sdkhpapdldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdal
gglkgdlagkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnne
knflvwineedhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyict
cptnmgtvvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarl
gkserelvqvlvdgvnlliacdkkleagqsiddmipk

SCOPe Domain Coordinates for d3l2ge2:

Click to download the PDB-style file with coordinates for d3l2ge2.
(The format of our PDB-style files is described here.)

Timeline for d3l2ge2: