| Class b: All beta proteins [48724] (126 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries) |
| Domain d12e8h2: 12e8 H:115-214 [21269] Other proteins in same PDB: d12e8h1, d12e8l1, d12e8l2, d12e8m1, d12e8m2, d12e8p1 |
PDB Entry: 12e8 (more details), 1.9 Å
SCOP Domain Sequences for d12e8h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d12e8h2 b.1.1.2 (H:115-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
Timeline for d12e8h2: