SCOP 1.65: Domain d12e8h2: 12e8 H:115-214

Lineage for d12e8h2 (12e8 H:115-214)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)

8. Domain d12e8h2: 12e8 H:115-214 [21269]
   Other proteins in same PDB: d12e8h1, d12e8l1, d12e8l2, d12e8m1, d12e8m2, d12e8p1

Details for d12e8h2

PDB Entry: 12e8, 1.9 Å

PDB Description: 2e8 fab fragment

SCOP Domain Sequences for d12e8h2:

Sequence; same for both SEQRES and ATOM records:

>d12e8h2 b.1.1.2 (H:115-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

Timeline for d12e8h2:

• d12e8h2 first appeared (with stable ids) in SCOP 1.55
  
• d12e8h2 appears in SCOP 1.63
  
• d12e8h2 appears in SCOP 1.67
  
• d12e8h2 appears in the current release, SCOPe 2.08