Lineage for d12e8h2 (12e8 H:115-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8707Species Fab 2E8 (mouse), kappa L chain [49066] (1 PDB entry)
  8. 8708Domain d12e8h2: 12e8 H:115-214 [21269]
    Other proteins in same PDB: d12e8h1, d12e8l1, d12e8m1, d12e8p1

Details for d12e8h2

PDB Entry: 12e8 (more details), 1.9 Å

PDB Description: 2e8 fab fragment
PDB Compounds: (H:)

SCOP Domain Sequences for d12e8h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d12e8h2 b.1.1.2 (H:115-214) Immunoglobulin (constant domains of L and H chains) {Fab 2E8 (mouse), kappa L chain}
kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
ytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d12e8h2:

Click to download the PDB-style file with coordinates for d12e8h2.
(The format of our PDB-style files is described here.)

Timeline for d12e8h2: