SCOP 1.61: Domain d12e8l2: 12e8 L:108-214

Lineage for d12e8l2 (12e8 L:108-214)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab 2E8 (mouse), kappa L chain [49066] (1 PDB entry)

8. Domain d12e8l2: 12e8 L:108-214 [21268]
   Other proteins in same PDB: d12e8h1, d12e8l1, d12e8m1, d12e8p1

Details for d12e8l2

PDB Entry: 12e8, 1.9 Å

PDB Description: 2e8 fab fragment

SCOP Domain Sequences for d12e8l2:

Sequence; same for both SEQRES and ATOM records:

>d12e8l2 b.1.1.2 (L:108-214) Immunoglobulin (constant domains of L and H chains) {Fab 2E8 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnsatdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d12e8l2:

• d12e8l2 first appeared (with stable ids) in SCOP 1.55
  
• d12e8l2 appears in SCOP 1.59
  
• d12e8l2 appears in SCOP 1.63
  
• d12e8l2 appears in the current release, SCOPe 2.08