SCOPe 2.03: Domain d3l2fb2: 3l2f B:114-390

Lineage for d3l2fb2 (3l2f B:114-390)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (5 species)
   not a true protein

7. Species Namalycastis sp. [TaxId:243920] [225847] (4 PDB entries)

8. Domain d3l2fb2: 3l2f B:114-390 [212662]
   Other proteins in same PDB: d3l2fa1, d3l2fb1, d3l2fc1, d3l2fd1, d3l2fe1, d3l2ff1, d3l2fg1, d3l2fh1, d3l2fi1, d3l2fj1, d3l2fk1, d3l2fl1, d3l2fm1, d3l2fn1, d3l2fo1, d3l2fp1, d3l2fq1, d3l2fr1
   automated match to d1qh4a2
   complexed with adp, mg, nmg, no3

Details for d3l2fb2

PDB Entry: 3l2f, 2.3 Å

PDB Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp., with transition state analog Mg(II)-ADP-NO3-glycocyamine. Part 1.

PDB Compounds: (B:) Glycocyamine kinase beta chain

SCOPe Domain Sequences for d3l2fb2:

Sequence; same for both SEQRES and ATOM records:

>d3l2fb2 d.128.1.0 (B:114-390) automated matches {Namalycastis sp. [TaxId: 243920]}
sdkhpapdldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdal
gglkgdlagkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnne
knflvwineedhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyict
cptnmgtvvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarl
gkserelvqvlvdgvnlliacdkkleagqsiddmipk

Timeline for d3l2fb2:

• d3l2fb2 is new in SCOPe 2.03-stable
  
• d3l2fb2 appears in SCOPe 2.04
  
• d3l2fb2 appears in the current release, SCOPe 2.08