Lineage for d3l2fb1 (3l2f B:4-113)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332344Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2332345Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2332410Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 2332411Protein automated matches [226884] (9 species)
    not a true protein
  7. 2332437Species Namalycastis sp. [TaxId:243920] [225846] (4 PDB entries)
  8. 2332447Domain d3l2fb1: 3l2f B:4-113 [212661]
    Other proteins in same PDB: d3l2fa2, d3l2fb2, d3l2fc2, d3l2fd2, d3l2fe2, d3l2ff2, d3l2fg2, d3l2fh2, d3l2fi2, d3l2fj2, d3l2fk2, d3l2fl2, d3l2fm2, d3l2fn2, d3l2fo2, d3l2fp2, d3l2fq2, d3l2fr2
    complexed with adp, mg, nmg, no3
    complexed with adp, mg, nmg, no3

Details for d3l2fb1

PDB Entry: 3l2f (more details), 2.3 Å

PDB Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp., with transition state analog Mg(II)-ADP-NO3-glycocyamine. Part 1.
PDB Compounds: (B:) Glycocyamine kinase beta chain

SCOPe Domain Sequences for d3l2fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2fb1 a.83.1.0 (B:4-113) automated matches {Namalycastis sp. [TaxId: 243920]}
aiqdyfvknrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvt
fdkciqtgvdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkp

SCOPe Domain Coordinates for d3l2fb1:

Click to download the PDB-style file with coordinates for d3l2fb1.
(The format of our PDB-style files is described here.)

Timeline for d3l2fb1: