SCOP 1.63: Domain d1g9nl2: 1g9n L:110-214

Lineage for d1g9nl2 (1g9n L:110-214)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries)
   binds to the CD4-induced state of gp120

8. Domain d1g9nl2: 1g9n L:110-214 [21266]
   Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh1, d1g9nl1

Details for d1g9nl2

PDB Entry: 1g9n, 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9nl2:

Sequence; same for both SEQRES and ATOM records:

>d1g9nl2 b.1.1.2 (L:110-214) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqk
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d1g9nl2:

• d1g9nl2 first appeared (with stable ids) in SCOP 1.55
  
• d1g9nl2 appears in SCOP 1.61
  
• d1g9nl2 appears in SCOP 1.65
  
• d1g9nl2 appears in the current release, SCOPe 2.08