Lineage for d1g9nl2 (1g9n L:110-214)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221803Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries)
    binds to the CD4-induced state of gp120
  8. 221809Domain d1g9nl2: 1g9n L:110-214 [21266]
    Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh1, d1g9nl1

Details for d1g9nl2

PDB Entry: 1g9n (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b

SCOP Domain Sequences for d1g9nl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9nl2 b.1.1.2 (L:110-214) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqk
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1g9nl2:

Click to download the PDB-style file with coordinates for d1g9nl2.
(The format of our PDB-style files is described here.)

Timeline for d1g9nl2: