![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
![]() | Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries) |
![]() | Domain d1g9nl2: 1g9n L:110-214 [21266] Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh1, d1g9nl1 |
PDB Entry: 1g9n (more details), 2.9 Å
SCOP Domain Sequences for d1g9nl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9nl2 b.1.1.2 (L:110-214) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqk skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg
Timeline for d1g9nl2: