Lineage for d1g9nl2 (1g9n L:110-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9181Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries)
  8. 9187Domain d1g9nl2: 1g9n L:110-214 [21266]
    Other proteins in same PDB: d1g9nc1, d1g9nc2, d1g9ng_, d1g9nh1, d1g9nl1

Details for d1g9nl2

PDB Entry: 1g9n (more details), 2.9 Å

PDB Description: hiv-1 yu2 gp120 envelope glycoprotein complexed with cd4 and induced neutralizing antibody 17b
PDB Compounds: (L:)

SCOP Domain Sequences for d1g9nl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9nl2 b.1.1.2 (L:110-214) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqk
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d1g9nl2:

Click to download the PDB-style file with coordinates for d1g9nl2.
(The format of our PDB-style files is described here.)

Timeline for d1g9nl2: