Lineage for d3l2ea2 (3l2e A:114-390)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1430621Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1430622Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 1430870Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 1430871Protein automated matches [227028] (5 species)
    not a true protein
  7. 1430956Species Namalycastis sp. [TaxId:243920] [225847] (4 PDB entries)
  8. 1430997Domain d3l2ea2: 3l2e A:114-390 [212656]
    Other proteins in same PDB: d3l2ea1, d3l2eb1, d3l2ec1, d3l2ed1
    automated match to d2crka2

Details for d3l2ea2

PDB Entry: 3l2e (more details), 2.6 Å

PDB Description: Glycocyamine kinase, alpha-beta heterodimer from marine worm Namalycastis sp.
PDB Compounds: (A:) Glycocyamine kinase alpha chain

SCOPe Domain Sequences for d3l2ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l2ea2 d.128.1.0 (A:114-390) automated matches {Namalycastis sp. [TaxId: 243920]}
sdkhpapdldhnklvggvfedkyvkscrircgrsvkgvclppamsraerrlvekvvsdal
gglkgdlagkyyplttmnekdqeqliedhflfekptgallttsgcardwpdgrgiwhnne
knflvwineedhirvismqkggdlkavfsrfarglleverlmkecghglmhndrlgyict
cptnmgtvvrasvhlrlaflekhprfdemlgklrlgkrgtggesslatdstydisnwarl
gkserelvqvlvdgvnlliacdkkleagqsiddmipk

SCOPe Domain Coordinates for d3l2ea2:

Click to download the PDB-style file with coordinates for d3l2ea2.
(The format of our PDB-style files is described here.)

Timeline for d3l2ea2: