| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
| Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
| Protein automated matches [226884] (9 species) not a true protein |
| Species Namalycastis sp. [TaxId:243920] [225846] (4 PDB entries) |
| Domain d3l2ea1: 3l2e A:18-113 [212655] Other proteins in same PDB: d3l2ea2, d3l2eb2, d3l2ec2, d3l2ed2 automated match to d1u6ra1 |
PDB Entry: 3l2e (more details), 2.6 Å
SCOPe Domain Sequences for d3l2ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2ea1 a.83.1.0 (A:18-113) automated matches {Namalycastis sp. [TaxId: 243920]}
fkdytrekfakenfpdlskhnnvmasqltyelyekywdkvtpngvtfdkciqtgvdnpgn
kfygkktgcvfgdeysyecykeffdkcieeihhfkp
Timeline for d3l2ea1: