Class a: All alpha proteins [46456] (286 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
Protein automated matches [226884] (6 species) not a true protein |
Species Namalycastis sp. [TaxId:243920] [225846] (4 PDB entries) |
Domain d3l2dd1: 3l2d D:12-113 [212653] Other proteins in same PDB: d3l2da2, d3l2db2, d3l2dc2, d3l2dd2 automated match to d1qh4a1 |
PDB Entry: 3l2d (more details), 2.4 Å
SCOPe Domain Sequences for d3l2dd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l2dd1 a.83.1.0 (D:12-113) automated matches {Namalycastis sp. [TaxId: 243920]} nrvghskpwesgkfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtg vdnpgnkfygkktgcvfgdeysyecykeffdkcieeihhfkp
Timeline for d3l2dd1: