SCOPe 2.06: Domain d3l2dc1: 3l2d C:24-113

Lineage for d3l2dc1 (3l2d C:24-113)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (7 species)
   not a true protein

7. Species Namalycastis sp. [TaxId:243920] [225846] (4 PDB entries)

8. Domain d3l2dc1: 3l2d C:24-113 [212651]
   Other proteins in same PDB: d3l2da2, d3l2db2, d3l2dc2, d3l2dd2
   automated match to d1qh4a1

Details for d3l2dc1

PDB Entry: 3l2d, 2.4 Å

PDB Description: Glycocyamine kinase, beta-beta homodimer from marine worm Namalycastis sp.

PDB Compounds: (C:) Glycocyamine kinase beta chain

SCOPe Domain Sequences for d3l2dc1:

Sequence; same for both SEQRES and ATOM records:

>d3l2dc1 a.83.1.0 (C:24-113) automated matches {Namalycastis sp. [TaxId: 243920]}
kfkaadnfpdlskhnnvmasqltkelyekywdkvtpngvtfdkciqtgvdnpgnkfygkk
tgcvfgdeysyecykeffdkcieeihhfkp

Timeline for d3l2dc1:

• d3l2dc1 first appeared in SCOPe 2.03
  
• d3l2dc1 appears in SCOPe 2.05
  
• d3l2dc1 appears in SCOPe 2.07
  
• d3l2dc1 appears in the current release, SCOPe 2.08