Lineage for d1gc1h2 (1gc1 H:130-229)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655245Domain d1gc1h2: 1gc1 H:130-229 [21265]
    Other proteins in same PDB: d1gc1c1, d1gc1c2, d1gc1g_, d1gc1h1, d1gc1l1, d1gc1l2
    part of HIV-1 neutralizing Fab 17B; binds to the CD4-induced state of gp120
    complexed with fuc, nag; mutant

Details for d1gc1h2

PDB Entry: 1gc1 (more details), 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody
PDB Compounds: (H:) antibody 17b

SCOP Domain Sequences for d1gc1h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc1h2 b.1.1.2 (H:130-229) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1gc1h2:

Click to download the PDB-style file with coordinates for d1gc1h2.
(The format of our PDB-style files is described here.)

Timeline for d1gc1h2: