Lineage for d1gc1h2 (1gc1 H:130-229)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 54030Species HIV-1 neutralizing Fab 17B (human), kappa L chain [49065] (3 PDB entries)
  8. 54033Domain d1gc1h2: 1gc1 H:130-229 [21265]
    Other proteins in same PDB: d1gc1c1, d1gc1c2, d1gc1g_, d1gc1h1, d1gc1l1

Details for d1gc1h2

PDB Entry: 1gc1 (more details), 2.5 Å

PDB Description: hiv-1 gp120 core complexed with cd4 and a neutralizing human antibody

SCOP Domain Sequences for d1gc1h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gc1h2 b.1.1.2 (H:130-229) Immunoglobulin (constant domains of L and H chains) {HIV-1 neutralizing Fab 17B (human), kappa L chain}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1gc1h2:

Click to download the PDB-style file with coordinates for d1gc1h2.
(The format of our PDB-style files is described here.)

Timeline for d1gc1h2: