Lineage for d3l1va_ (3l1v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920176Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
    no insertion subdomains
  6. 2920177Protein D,D-heptose 1,7-bisphosphate phosphatase GmhB [159534] (1 species)
  7. 2920178Species Escherichia coli [TaxId:562] [159535] (8 PDB entries)
    Uniprot P63228 4-185
  8. 2920189Domain d3l1va_: 3l1v A: [212645]
    automated match to d2gmwa1
    complexed with ca, po4, zn

Details for d3l1va_

PDB Entry: 3l1v (more details), 1.95 Å

PDB Description: crystal structure of gmhb from e. coli in complex with calcium and phosphate.
PDB Compounds: (A:) D,D-heptose 1,7-bisphosphate phosphatase

SCOPe Domain Sequences for d3l1va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l1va_ c.108.1.19 (A:) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}
svpaifldrdgtinvdhgyvheidnfefidgvidamrelkkmgfalvvvtnqsgiargkf
teaqfetltewmdwsladrdvdldgiyycphhpqgsveefrqvcdcrkphpgmllsardy
lhidmaasymvgdkledmqaavaanvgtkvlvrtgkpitpeaenaadwvlnsladlpqai
kk

SCOPe Domain Coordinates for d3l1va_:

Click to download the PDB-style file with coordinates for d3l1va_.
(The format of our PDB-style files is described here.)

Timeline for d3l1va_: