SCOPe 2.06: Domain d3l1ua_: 3l1u A:

Lineage for d3l1ua_ (3l1u A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
   no insertion subdomains

6. Protein D,D-heptose 1,7-bisphosphate phosphatase GmhB [159534] (1 species)

7. Species Escherichia coli [TaxId:562] [159535] (8 PDB entries)
   Uniprot P63228 4-185

8. Domain d3l1ua_: 3l1u A: [212643]
   automated match to d2gmwa1
   complexed with ca, zn

Details for d3l1ua_

PDB Entry: 3l1u, 1.95 Å

PDB Description: crystal structure of calcium-bound gmhb from e. coli.

PDB Compounds: (A:) D,D-heptose 1,7-bisphosphate phosphatase

SCOPe Domain Sequences for d3l1ua_:

Sequence; same for both SEQRES and ATOM records:

>d3l1ua_ c.108.1.19 (A:) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}
svpaifldrdgtinvdhgyvheidnfefidgvidamrelkkmgfalvvvtnqsgiargkf
teaqfetltewmdwsladrdvdldgiyycphhpqgsveefrqvcdcrkphpgmllsardy
lhidmaasymvgdkledmqaavaanvgtkvlvrtgkpitpeaenaadwvlnsladlpqai
kk

Timeline for d3l1ua_:

• d3l1ua_ first appeared in SCOPe 2.03
  
• d3l1ua_ appears in SCOPe 2.05
  
• d3l1ua_ appears in SCOPe 2.07
  
• d3l1ua_ appears in the current release, SCOPe 2.08